Skip to main content

Advertisement

Table 5 Major motifs in Arabidopsis and rice IQD proteins

From: Genome-wide comparative analysis of the IQD gene families in Arabidopsis thaliana and Oryza sativa

Motifa Multilevel consensus sequenceb
1 EEWAAIKIQTAFRGYLARRALRALKGLVRLQALVRGHLVRKQAAMTLRCMQALVRVQAQVRR
2 MGKKGKWFKSLFGGF
3 SWFTAVKRIFISPTK
4 NKKWKLWRTSSED
5 EKRRWSFRKSS
6 PPCPPPPPPHH
7 KHAIAVAIATAAAAEAAVAAA
8 QAAAEVVRLTS
9 SEENQALQKQLHQKHHHE
10 GEDWDDSILSK
11 EEIEAKLQMRQEAAIKRERAMAYAFSHQW
12 WKNSSKTGNPTFMDP
13 DNPNWGWNWLERWMA
14 ARPWENRLMDD
15 YEENPKIVEMDTGKPYY
16 GSMNDDESFTSCPDF
17 PNYMANTESAKAKVRCQSAPR
18 SAKKRLSFPN
19 DHVKEIEEGWCDSIG
20 WMEKLTNNAFADKLLASSPTTLPLH
  1. a Numbers (1–20) correspond to the motifs schematically presented in the reference bars of Figure 3. Motif 1 corresponds to the IQ67 consensus sequence. The remaining motifs are listed in the order as they occur in the primary structures of IQD proteins, continuing with motifs most N-terminal.
  2. b Sequences were obtained from the MEME analysis of the 61 Arabidopsis and rice IQD full length proteins. Only consensus sequences that are shared by at least four Arabidopsis IQD proteins are listed.