Newly evolved introns in human retrogenes provide novel insights into their evolutionary roles

  • Li-Fang Kang1,

    Affiliated with

    • Zheng-Lin Zhu1Email author,

      Affiliated with

      • Qian Zhao1,

        Affiliated with

        • Li-Yong Chen2Email author and

          Affiliated with

          • Ze Zhang1

            Affiliated with

            BMC Evolutionary Biology201212:128

            DOI: 10.1186/1471-2148-12-128

            Received: 30 March 2012

            Accepted: 19 July 2012

            Published: 28 July 2012

            Abstract

            Background

            Retrogenes generally do not contain introns. However, in some instances, retrogenes may recruit internal exonic sequences as introns, which is known as intronization. A retrogene that undergoes intronization is a good model with which to investigate the origin of introns. Nevertheless, previously, only two cases in vertebrates have been reported.

            Results

            In this study, we systematically screened the human (Homo sapiens) genome for retrogenes that evolved introns and analyzed their patterns in structure, expression and origin. In total, we identified nine intron-containing retrogenes. Alignment of pairs of retrogenes and their parents indicated that, in addition to intronization (five cases), retrogenes also may have gained introns by insertion of external sequences into the genes (one case) or reversal of the orientation of transcription (three cases). Interestingly, many intronizations were promoted not by base substitutions but by cryptic splice sites, which were silent in the parental genes but active in the retrogenes. We also observed that the majority of introns generated by intronization did not involve frameshifts.

            Conclusions

            Intron gains in retrogenes are not as rare as previously thought. Furthermore, diverse mechanisms may lead to intron creation in retrogenes. The activation of cryptic splice sites in the intronization of retrogenes may be triggered by the change of gene structure after retroposition. A high percentage of non-frameshift introns in retrogenes may be because non-frameshift introns do not dramatically affect host proteins. Introns generated by intronization in human retrogenes are generally young, which is consistent with previous findings for Caenorhabditis elegans. Our results provide novel insights into the evolutionary role of introns.

            Background

            Retroposition, or RNA-based duplication, is the process by which reverse-transcribed mRNAs are inserted into new genomic positions, which generates retrocopies [1]. Retrocopies are assumed not to carry the regulatory regions, but by chance they may obtain functions by recruiting new regulatory elements, and then become functional retrogenes [27]. These newly evolved genes may acquire introns in the untranslated regions by capture of nearby exons into a new genomic environment or fusion with host genes, which is chimerization based on intron gain [38]. Such retrogenes are usually considered to be intronless because introns were not inherited from the parents. However, in some circumstances, retrogenes may recruit internal exonic sequences as introns [9, 10], which is known as intronization [11].

            Since intronization of retrogenes was first reported [9], this kind of evolutionary event has been commonly observed in plants. In Arabidopsis and Populus, 29 retrogenes have undergone intronization, which represent about 15.3 % of all known retrogenes [10]. In contrast, rare cases are reported in vertebrates [12, 13]. Previously, only two retrogenes were found to be intronized in mammals [14]. This frequency is extremely low given the thousands of retrocopies in the human (Homo sapiens) genome [1517]. How general retrogene intronization is remains unknown. In the present study, we scanned the human genome for intronized retrogenes and identified nine cases not reported previously. Our results provide new insights into the mechanism of intron gain and expression patterns of retrogenes.

            Methods

            Scanning for intron gain in retrogenes

            The human genome data were downloaded from the UCSC Genome Browser database (release hg19) [18, 19]. Then, we used the approach of Zhu et al. [10] to search the data for retrocopies. First, we mapped human protein sequences onto the genome with tBLASTn [20] and used the Pseudopipe package [21] to process the raw alignments with the default settings, including tBLASTn e-value cutoff (1e-10), coverage cutoff (70 %) and identity cutoff (40 %). Next, we retained candidates with more than three introns absent or only one or two introns absent but with a small K s (<2) or other RNA-based duplication evidence, for example, a poly(A) track. Finally, as described previously [10], we set filters to discard possible DNA-based duplication cases. In brief, we discarded all retrocopies in which at least 50 % of the region overlapped with repeats or with flanking genes similar to the parental gene’s flanking regions. We also discarded all retrocopies that aligned well with the introns of the parents. Ultimately, we identified 3436 retrocopies.

            We wrote a series of PERL programs to look for intron-containing retrogenes on the basis of annotations from ENSEMBL (GRCh37) [22, 23]. We identified 54 candidates of intronized retrogenes for further study.

            Gene structure validation by transcription evidence

            We utilized the mRNA and EST annotations from the UCSC Genome Brower Database to search for transcription evidence of intron gain in retrogenes [18, 19]. For each sample, we inspected the annotated intronic region to see whether there were transcripts that support its splicing. If transcripts were present, we mapped them on the human genome with BLAT [24] to check whether these transcripts uniquely correspond to the retroposed region. By this method, eight intron-containing retrogenes were validated (Additional files 1 and 2).

            K a and K s calculation

            We estimated the non-synonymous substitution rate (K a), synonymous substitution rate (K s) and K a/K s values between the intronic regions of retrogenes and their parental copies, by implementing the codeml program in the PAML package following the Nei-Gojobori method [25, 26] and analyzed the results with the likelihood ratio test. We did K a/K s estimation between the exonic regions of retrogenes and their parental copies in the same way.

            RT-PCR

            In order to validate the structure of the retrogenes, we collected samples of 16 human tissues from Daping Hospital, Chongqing, for experiments (Additional file 3). Following the manufacturer’s instructions, we used TRIzol Reagent (Invitrogen, Carlsbad, CA) to isolate RNA and digested the contaminating genomic DNA with RNase-free DNase I (Promega, Madison, WI). cDNAs were synthesized with Moloney murine leukemia virus reverse transcriptase (Promega). We performed PCR in a 25 μl reaction volume, and 5 μl of the PCR products were electrophoresed on a 1.2 % agarose gel. To validate whether the smaller-sized bands represented the retrogenes, we cloned and sequenced those PCR products. Ultimately, we identified two samples in which the sequences of the smaller-sized bands belonged to retrocopies and the larger bands to the parental genes (Additional file 4).

            Peptide support for intronized retrogenes

            To identify whether one retrogene was expressed at the protein level, we sought peptide evidence in the PeptideAtlas [2729] and PRIDE [30, 31] databases using the gene name. Each search result displayed experimental details including the fractionation and sequencing (by mass spectroscopy or other methods) of short peptides. Among the results, we extracted peptides that matched the protein sequence of the intronized retrogene. Given that one peptide may match many proteins, we also used BLASTp [32, 33] to ensure that the peptide specifically mapped to the gene we targeted. We only retained peptides for which the best hit was a targeted protein.

            Age estimation of the retrogenes

            We examined the presence and absence of orthologs in the phylogenetic tree for vertebrates and used the established origination times of all human genes [34] to infer the times of origin of the retrogenes. For comparison we used the same method to estimate the time of origin of 27 retrogenes that recruited introns by chimerization [8]. We mapped the results on the vertebrate phylogeny (Additional files 5 6 and 7). The timeline and divergence time of species in the phylogeny were reconstructed based on data from the UCSC Genome Browser database and other sources [19, 3440].

            Detection of splicing signals

            We detected splicing signals of new introns with SROOGLE [41]. For an intron X, if its upstream exon is Y and downstream exon is Z, we used X and Y to detect signals of the 5′ splice site (SS) and X and Z for that of the branch site (BS), polypyrimidine tract (PPT), and 3′ SS. We performed two detections for each intron; one was performed on the parental gene and the other was done for the retroposed sequence. The former and latter were considered to represent the status before retroposition and the current status, respectively. Finally, for each detection, we recorded the percentile score for constitutive introns, which was obtained from a data set composed of >50,000 constitutive introns [41], because all introns in our data set showed no evidence for alternative splicing (Additional file 8).

            Results

            Identification of intron gain in retrogenes

            We focused on identifying retrogenes that contain introns and scanned the human genome using a published pipeline [10]. We mapped all human proteins onto the genome with tBLASTn [20] and extracted all possible candidates of retrocopies from among the results with PseudoPipe [21]. Then, we set filters to exclude cases that did not fulfill the properties of retroposition and obtained 3436 retrocopies. Finally, we determined that 54 of the 3436 retrocopies contained introns on the basis of gene structure annotations from ENSEMBL [22, 23].

            We used two methods to validate the existence of retrogene introns. First, we collected information from the UCSC Genome Browser database [18, 19] and found eight cases with confident transcriptional evidence (Additional file 2). Next, we performed experiments to validate the existence of the retrogene introns. Given the high similarity in the flanking regions of new introns for most retro-parental alignments, we designed pairs of primers whose products (Additional file 9) spanned the intronic regions for both the retrogenes and their parental genes. Theoretically, the amplified segments from the retrogenes (without the intronic sequences) would be smaller than those of the parental genes (with the intronic sequences). By this method, we confirmed that two retrogenes contained introns (Additional file 4), one of which was one of the eight retrogenes mentioned above. In total, we identified nine retrogenes that evolved introns in the retroposed regions (Table 1). Our data did not include RNF113B and DCAF12, which were reported in a previous study [14], because the parents of these two retrogenes were lost after the divergence of mammals from vertebrates, whereas our pipeline used parental protein sequences as queries to search for retrocopies. In addition, we discarded POM121L2 and ARPM1, which were suggested to be intronized retrogenes previously [8], because the alignment identities of these retrogenes and their respective parents did not fulfill the criteria set in our pipeline (>40 % identity).
            Table 1

            Nine human retrogenes that gained introns investigated in this study

            Retrogene

            Parent

            Movement

            Intron (+)

            Intron (−)

            Evidence

            TMEM14D

            TMEM14B

            10 < −6

            1

            4

            A

            RPS3AP5

            RPS3A

            10 < −4

            1

            5

            B

            XXyac-R12DG2.2

            RCN1

            13 < −11

            2*

            5

            B

            HSP90B2P

            HSP90B1

            15 < −12

            2

            16

            B

            HSP90AA4P

            HSP90AA1

            4 < −14

            3

            9

            A,B

            HSP90AA5P

            HSP90AA1

            3 < −14

            2

            7

            B

            CSMD3

            RPL18

            8 < −19

            1

            5

            B

            WBP2NL

            SLC25A5

            22 < −X

            1

            3

            B

            AC019016.1

            CSNK1A1

            15 < −5

            2*

            8

            B

            In the column ‘Movement’, ‘10 < −6’ means a new gene on chromosome 10 is retroposed from a gene on chromosome 6, for example. ‘Intron (−)’ and ‘Intron (+)’ are the numbers of intron losses and intron gains in retrocopies, respectively. For ‘Evidence’, ‘A’, confirmed by RT-PCR; ‘B’, supported by convincing transcription evidence. ‘*’ means that the newly evolved intronic regions of XXyac-R12DG2.2 and AC019016.1 could be spliced in two patterns, respectively.

            Mechanisms of intron gain in retrogenes

            To clarify the intron-gain mechanisms of these retrogenes, we produced protein and nucleotide sequence alignments for the retrogenes and their respective parental genes (Additional files 10 and 11). For RPS3AP5, we observed that its intronic region did not have counterparts in the parental gene. This result indicated that this retrogene did not gain the intron by intronization, but rather by insertion of an external sequence (Figure 1A). Using the inserted sequence as a query for a BLAT [24] search against the human genome, we identified more than five paralogous sequences with identity >95 % and coverage >70 %. The new intron may be derived from one of these paralogs. By checking the genome annotations in the UCSC Genome Browser database [18, 19], we found that none of these paralogs were annotated as introns. Thus, the new intron may not have originated by ‘reverse splicing’, the process by which a spliced-out intronic RNA is inserted into a novel site of one RNA gene transcript by reversal of the splicing reaction [12, 42]. The intron may have been created by a mechanism not reported previously.
            http://static-content.springer.com/image/art%3A10.1186%2F1471-2148-12-128/MediaObjects/12862_2012_2236_Fig1_HTML.jpg
            Figure 1

            Mechanisms of intron gain in retrogenes. In the parental gene, rectangles represent exons, ‘H’-like tags represent introns, the retroposed regions are indicated in purple, and other regions are indicated in blue. In the retrogene, the retroposed region is indicated in purple and the newly evolved intronic regions are indicated in yellow. Semi-rectangle lines with arrows indicate the direction of transcription. (A) The retrogene RPS3AP5 gained an intron by insertion of an external sequence; (B) the retrogene XXyac-R12DG2.2 evolved a new intron after transcription in the opposite orientation compared to the parent; (C) in retrogene HSP90AA4P three new introns were generated by intronization. There is no mutation at the splice sites in the two introns near the 5′ terminus, whereas one transition from ‘A’ to ‘G’ (indicated in red) at the splice sites occurred in the intron near the 3′ terminus.

            We observed that three retrogenes (XXyac-R12DG2.2, CSMD3 and WBP2NL) were transcribed in the reverse direction relative to that of their parents. For XXyac-R12DG2.2 there are 10 annotated transcription patterns and introns appeared in four of the 10 patterns (Additional file 2). Taking ENST00000379050 as an example, the retrocopy contained a 170 bp intron, and its splicing donor and acceptor sites (‘GT’ and ‘AG’) had reverse counterparts (‘AC’ and ‘AT’) in the parental gene (Figure 1B, Additional files 10 and 11). Thus, transcription in the reverse orientation led to the origin of the intron splicing sites. For the remaining three transcription patterns (ENST00000522673, ENST00000519494 and ENST00000330825), the newly evolved intron was shorter (127 bp) and the retroposed sequence was located near the 3′ end. In addition, the retrocopy is inserted near the 3′ end of a ncRNA gene candidate (LOC 100190939, Additional file 12).

            In CSMD3, the retroposed region was located at the 5′ untranslated region (UTR) of the mRNA. Some part of the retrocopy had changed into an intergenic sequence, and some part acted as a portion of an intron (Additional files 2 and 12). The retrogene was located in the first intron of WBP2NL (Additional file 12). Nevertheless, the retrocopy might be transcribed at least some of the time, because an mRNA sequence, BC03789, supports the transcription of this retrogene (Additional file 1 and 2). We did not find evidence for protein-level expression of the three retrogenes that gained an intron after transcription in the reverse orientation. The new introns in these three retrogenes were annotated to be in non-coding regions.

            The remaining five retrogenes had gained introns through intronization, which generated 10 new introns. Taking HSP90AA4P as an example, three exonic sequences were changed into introns (Figure 1C). Eight of the 10 introns had the canonical splicing boundaries ‘GT-AG’. 80 % (8/10) of the introns arose in ORF and 20 % (2/10) in UTRs.

            In total, we observed three mechanisms of intron gain for these retrogenes. In addition to intronization, retrogenes may gain introns after insertion of external sequences or transcription in the opposite orientation compared to the parent (Figure 1).

            Non-frameshift introns generated by intronization had greater evolutionary success

            For the five retrogenes that underwent intronization, we examined the alignments of retrocopies and their corresponding parental sequences to assess whether these introns had disturbed the frame of putative translation inherited from the parental genes (Additional file 11). If one intron disturbed the frame, we termed it a frameshift intron, otherwise it was considered to be a non-frameshift intron. The lengths of the corresponding sequences of the five retrogenes (70 %) were in multiples of three bases. We performed a manual check for each retrogene. At the location 100 bp upstream of the second intron of HSP90AA4P (from 5′ to 3′, HSP90AA4P-2), we observed an insertion of 23 bases. The length of HSP90AA4P-2 was 83 bp. Thus, compared with the parent, the intron and insertion led to an overall loss of 60 bases (divisible by three) in the transcript. Similarly, for HSP90AA5P we observed an insertion of 22 bases located 1 bp upstream of the intron near the 5′ terminus (HSP90AA5P-1) and a deletion of four bases located 2 bp upstream of the intron near the 3′ terminus (HSP90AA5P-2). The lengths of these two introns were 439 and 254 bp, respectively. As in HSP90AA4P-2, both the indels and intronization shortened the coding sequences by 417 and 258 bp in HSP90AA5P-1 and HSP90AA5P-2, respectively (both numbers are divisible by three). Both were classified as non-frameshift introns. The two alternative spliced introns of AC019016.1 were annotated to be UTR-region introns according to the UCSC database [18, 19] and Ensembl [22, 23].

            In total, eight of the 10 introns created by intronization were non-frameshift introns. This proportion (80 %) is significantly higher than the percentage of frameshift introns generated by chimerization based on intron-gain retrogenes (29.8 %, 16/49) (P-value = 0.017) [8]. From searches of PeptideAtlas [2729] and PRIDE [30, 31], we found that the predicted proteins of HSP90B2P, HSP90AA4P and HSP90AA5P had respective unique matching peptides (Table 2), which indicated the true protein-coding activity of these transcripts. Consistent with findings for Caenorhabditis elegans[11], our observations showed that non-frameshift introns had greater evolutionary success.
            Table 2

            Peptide support for intronized retrogenes

            Gene name

            Peptide match

            Peptide database referencea

            Location in protein seq

            BLASTP hitsb

            HSP90B2P

            NLNFVKGVVDSGGLSLNVSCETLQQHK

            PRIDE: 8670

            86

            Self (4e-19, 100 %)

            IEKAMVSQCLTESLCALVASQYGWSGNMER

            PRIDE: 8670

            270

            Self (4e-24, 100 %)

            AMVSQCLTESLCALVASQYGWSGNMER

            PRIDE: 8671; 8668

            273

            Self (7e-21, 100 %)

            MAETIQEVEDEYKAFCK

            PRIDE: 8672

            1

            Self (9e-11, 100 %)

            CVFITDDFRDTMPK

            PRIDE: 8669

            72

            Self (7e-08, 100 %)

            HSP90AA4P

            HNNDEQYAWESSLR

            PeptideAtlas: PAp00393519

            93

            Self (1e-07, 100 %)

            ADLINNLGTITK

            PeptideAtlas: PAp01587648

            20

            Self (8e-04, 100 %)

            DQVANSTIVQR

            PeptideAtlas: PAp00565957

            207

            Self (0.005, 100 %)

            HSP90AA5P

            IKEIVKKHSQFIGYPITLFVEKKR

            PeptideAtlas: PAp00040955; PAp00423980

            33

            Self (2e-17, 100 %)

            HGLEVIYMIELIDKYCVQQLK

            PeptideAtlas: PAp00040711

            199

            Self (2e-15, 100 %)

            ‘a’, Database name and experiment numbers or identifiers. ‘b’, BLASTP search against the GenBank non-redundant protein database (e-value and maximum identity of the match are shown in parentheses [32, 33]).

            Retrogenes underwent intronization by cryptic splicing sites

            Previous studies showed that most intronizations were caused by base substitutions at the 5′ and 3′ SS [10, 11]. However, we observed only four such cases (40 % of all cases) in our data set. By inspecting the EST annotations for the corresponding parental regions of all newly intronized introns, we found that none of these intronized introns was created by inheriting alternative splicing sites from the parental gene. What led to the creation of the other six retrogene introns? Since a retrogene does not contain introns compared with its parental gene, we proposed that the new introns were created by cryptic splice sites in the exonic regions of the parents. That is, cryptic splice sites were silent in the parents, but were activated in the retrogenes after retroposition and the new introns were generated. To test our hypothesis, we used SROOGLE [41] to detect the splicing signals (5′ SS, 3′ SS, the PPT located upstream of the 3′ SS, and the BS located upstream of the PPT) of the retrogene introns and their respective corresponding regions in the parental genes. The splicing signals of introns in four of the six retrogenes were increased, except for those of TMEM14D and HSP90B2P (Figure 2, Table 3). For the latter two retrogenes, in the parental gene the corresponding regions of the retrogene introns had lower splicing signals compared with those of neighboring introns (Additional file 13 and Additional file 14). It is likely that these cryptic intronic regions were oppressed in the parental genomes and the oppression was released after retroposition. The splice sites of these six new introns pre-existed but were cryptic in the parental genes. After retroposition, the splice sites were activated in the novel genomic environments. In addition, for the four introns that showed base substitutions at their splice sites, the splicing signals increased not only at the 5′ SS and 3′ SS but also at the BS and PPT (Table 3). In addition to point mutation, the change in gene structure after retroposition might also contribute to the evolution of new introns.
            http://static-content.springer.com/image/art%3A10.1186%2F1471-2148-12-128/MediaObjects/12862_2012_2236_Fig2_HTML.jpg
            Figure 2

            Comparison of splicing signals of retrogene introns (after retroposition) and their corresponding regions in the parental gene (before retroposition). The y-axis is the sum of the percentile scores of four different signals, comprising the branch site (BS), polypyrimidine tract (PPT), and 5′ and 3′ splice sites (Table 3). The higher the score, the stronger the splicing signal. Scores for BS and PPT were calculated with algorithm ‘K’ [47] and those for the splice sites were calculated with ‘M’ [48] by SROOGLE [41]. Six different retrogene introns are plotted on the x-axis. If a retrogene evolved only one intron (TMEM14D), we used the gene name to represent the intron, or we marked different introns in one retrogene in the format of the gene name plus a serial number following the hyphen. For example, ‘HSP90AA4P-1’ represents the first intron (in the direction from 5′ to 3′) in the retrogene HSP90AA4.

            Table 3

            Percentile scores [41] of splicing signals of retrogene introns (after retroposition) and their corresponding regions in the parental gene (before retroposition)

            Intron symbol

            Splice sites

            After retroposition

            Before retroposition

              

            BS (K)

            PPT (K)

            5′ SS (M)

            3′ SS (M)

            BS (K)

            PPT (K)

            5′ SS (M)

            3′ SS (M)

            TMEM14D

            GC-AG

            0.14

            0.06

            0.02

            0.02

            0.14

            0.04

            0.01

            0.11

            (HSP90B2P-1)

            GT-AG

            0.39

            0.39

            0

            0.01

            0.39

            0.24

            0

            0

            HSP90B2P-2

            GT-AG

            0.5

            0.03

            0

            0.01

            0.5

            0.02

            0

            0.02

            HSP90AA4P-1

            GT-AG

            0.21

            0.03

            0.04

            0.12

            0

            0

            0.04

            0

            HSP90AA4P-2

            GT-AG

            0.03

            0.06

            0.04

            0.28

            0.03

            0.06

            0.04

            0.25

            (HSP90AA4P-3)

            GT-AG

            0.56

            0.33

            0

            0.03

            0.56

            0.22

            0

            0.02

            (HSP90AA5P-1)

            TT-AG

            0.25

            0.27

            0

            0.54

            0

            0

            0

            0

            HSP90AA5P-2

            GT-AG

            0.45

            0.45

            0.01

            0.15

            0.12

            0.15

            0.01

            0.21

            AC019016.1-1

            GT-AG

            0.91

            0.35

            0.11

            0.84

            0.61

            0.35

            0.11

            0.82

            (AC019016.1-2)

            GT-AG

            0.91

            0.35

            0.47

            0.84

            0.61

            0.35

            0

            0.82

            The higher the score, the stronger the splicing signal is. The scores for BS and PPT were calculated with the ‘K’ algorithms [47], and those for 5′ SS and 3′ SS were calculated with ‘M’ [48] by SROOGLE [41]. The intron symbol is in the format of the gene name plus a serial number following the hyphen. For example, ‘HSP90B2P-1’ indicates the first intron (in the direction from 5′ to 3′) in HSP90B2P. If a retrogene evolved only one intron (TMEM14D), the intron is represented by the gene name. In the column ‘Intron symbol’, parentheses indicate that the splice sites underwent base substitution.

            Intronization tended to occur in young retrogenes

            In C. elegans, intronization is reported to be a major contributor to intron creation and most introns generated by this mechanism are young [11]. In our data set, 66.7 % of retrogene introns (10/15) were created by intronization. This finding is consistent with previous studies [11]. We used the established origination times of all human genes to trace the time of origin of intronized retrogenes [34] and examined the presence and absence of the corresponding orthologs in the vertebrates phylogeny (Additional file 6). We found that 80 % (4/5) of the intronized retrogenes were primate specific. We also recalculated the ages of 27 chimerizations based on intronized retrogenes with the same method [8] (Additional file 7) and found that only 18.5 % of intronized retrogenes (5/27) were primate specific. This finding indicated that intronization tended to occur in young retrogenes (proportion test, P = 0.023). Furthermore, in our data set, no intronized retrogene (0/5) was retroposed from chromosome X (‘out-of-X’). The retrogenes from chromosome X were mostly old and evolved after the divergence of eutherian mammals (human or mouse) and marsupials (opossum) [34]. For retrogenes that underwent intron gains by chimerization, the proportion of ‘out-of-X’ retrogenes was 37 % (Additional file 7). Therefore, the comparison of 0 % and 37 % reinforced the conclusion that intronization tended to occur in young retrogenes.

            Evolutionary rates of intronized retrogenes

            To evaluate the evolutionary rates of retrogenes, we calculated K a, K s, and K a/K s values between the intronic regions of retrogenes and their parental copies as well as between the exonic regions of retrogenes and their parental copies. The K a values in the intronic regions were higher than those in the exonic regions (Meanintronic = 0.207, Meanexonic = 0.111, Wilcoxon two-sample test, P-value = 0.098; Table 4). Similarly, K s values in the intronic regions were higher than those in the exonic regions (Meanintronic = 0.263, Meanexonic = 0.151, Wilcoxon two-sample test, P-value = 0.194). These findings are consistent with the conclusion that introns evolved faster than exons.
            Table 4

            Substitution rates between the intronic and exonic regions of retrogenes and their corresponding regions of parental genes

            Retrogene

            Intronic region

            Exonic region

             

            K a

            K s

            K a/K s

            P-value

            Length

            K a

            K s

            K a/K s

            P-value

            Length

            TMEM14Dc

            0.062

            0.058

            1.074

            0.936

            105

            0.006

            0.014

            0.440

            0.570

            237

            RPS3AP5a

            NA

            NA

            NA

            NA

            NA

            0.017

            0.014

            1.210

            0.172

            780

            XXyac-R12DG2.2b

            0.024

            0.029

            0.830

            0.892

            129

            0.008

            0.012

            0.643

            0.631

            813

            HSP90B2Pac,*

            0.823

            0.597

            1.379

            0.526

            144

            0.045

            0.067

            0.678

            0.091

            2163

            HSP90AA4Pc,*

            0.104

            0.277

            0.374

            0.000

            744

            0.055

            0.085

            0.656

            0.000

            1374

            HSP90AA5Pc,*

            0.087

            0.215

            0.406

            0.001

            672

            0.088

            0.221

            0.400

            0.082

            897

            CSMD3b

            0.313

            0.575

            0.544

            0.051

            291

            0.186

            0.282

            0.659

            0.310

            225

            WBP2NLb

            0.033

            0.088

            0.373

            0.192

            177

            0.385

            0.377

            1.021

            0.919

            684

            AC019016.1c

            0.083

            0.082

            1.010

            0.978

            636

            0.081

            0.175

            0.466

            0.084

            273

            K a represents the non-synonymous substitution rate and K s indicates the synonymous substitution rate. The P-value was calculated with the likelihood ratio test and the null hypothesis was K a/K s =1. NA: not available (the corresponding parental sequence of the new intron in retrogene RPS3AP5 did not exist, because the intron was created by insertion of an external sequence). ‘a’, The retrogene gained introns by insertion of an external sequence. ‘b’, The retrogene gained introns after transcription in the opposite orientation compared to the parent. ‘c’, The retrogene gained introns by intronization. ‘*’, Evidence at the protein level for transcription of the retrogene was obtained.

            In addition, the exonic regions of most intronized retrogenes had K a/K s values smaller than 1 (P-value < 0.1), which suggested that the corresponding regions were under negative selection. By checking for evidence of expression, we found that three of the five intronized retrogenes showed evidence for expression at the protein level and the additional two retrogenes showed transcription evidence at the RNA level. This result indicated that most intronized retrogenes were functional and should be under negative selection.

            With regard to the three retrogenes that gained introns after transcription in the opposite orientation compared with the parent, they were annotated to be in the non-coding regions of other genes. We observed that CSMD3 and WBP2NL evolved faster than the other retrogenes (Table 4). This finding is consistent with the conclusion that non-coding regions such as UTR regions are under less functional constraint than coding regions. However, XXyac-R12DG2.2 evolved slowly relative to that of CSMD3 and WBP2NL. Thus, XXyac-R12DG2.2 is likely to be under functional constraint.

            Discussion

            In this study, we systematically searched the human genome for retrogenes that underwent intron gain in the coding region and in total identified 15 retrogene introns. These newly generated introns evolved at a faster rate than neighboring exons. In contrast to the findings in plants [10], we found that intron gain events in retrogenes were rare in humans. In spite of this rarity, the mechanisms of intron creation in these retrogenes are diverse. We found that retrogenes could gain introns in three ways: insertion from an external sequence, transcription in the opposite direction compared with the parent, and intronization. For the latter method, in addition to base substitution, retrogenes also may create introns in exonic regions via cryptic splice sites, which might be activated by the new gene structure after retroposition. Consistent with the findings in C. elegans[11], retrogene introns generated by intronization in humans are generally young and are mostly located in the coding region of the new gene. The retrogenes that underwent intronization in coding regions all retained the parental frames of translation and most showed expression evidence at the protein level. The significantly higher percentage of non-frameshift introns implied that this kind of intron possessed a higher likelihood of persistence after intronization. The reason for this may be that frameshift introns mostly have a major effect on the proteins. Thus, non-frameshift introns are more likely to survive. However, non-frameshift introns may be neutral in effect, as proposed previously [43, 44]. Furthermore, previous studies have shown that the rate of intron loss is much larger than that of intron gain in mammals [12, 13, 45]. Consequently, the older the retrogene is, the more probable the retrogene will lose the intronized exon, and this may explain why such introns are mainly observed in young retrogenes.

            Some questions arise from careful examination of our observations. For example, for the retrogene RPS3AP5, in which the new intron was created by insertion of an external sequence, the process by which the new intron was created is unknown. In addition, in searches of UCSC [18, 19], Ensembl [22, 23], PeptideAtlas [2729] and PRIDE [30, 31], we did not obtain evidence of protein-level expression for the three retrogenes that gained introns after transcription in the reverse orientation compared with their parents. The new introns in these three retrogenes were annotated to be in non-coding regions and appeared to be parts of existing intron-containing genes, as described previously [7]. Thus, these retrogenes generally evolved faster than intronized retrogenes (Table 4).

            For the eight non-frameshift introns generated by intronization, we examined whether they are under natural selection by checking their genetic variation in different human populations with the 1000 Genomes Browser [46]. However, we did not find insertions, deletions or mutations in splice sites in seven of these retrogenes (Additional file 14), which implied that they are nearly fixed in all populations and may be under negative selection. In addition, there is a possibility that this pattern observed was caused by genetic drift because generation of new introns may be neutral. Finally, what is the importance of producing a shorter protein than the protein from the parent gene? This question may be answered by comparing the functions of the original proteins and that encoded by the retrogenes in the future.

            Conclusions

            Our results showed that retrogenes may gain introns in three ways: insertion from an external sequence, transcription in the reverse direction compared to that in the parent, and intronization. In addition to base substitution, intronization also may be promoted by cryptic splice sites. For introns generated by intronization, non-frameshift introns might have greater evolutionary success than frameshift introns, because non-frameshift introns have only a small effect on the host proteins or are neutral. Furthermore, intronization tended to occur in young retrogenes.

            Abbreviations

            BS: 

            branch site

            PPT: 

            polypyrimidine tract

            SS: 

            splice site.

            Declarations

            Acknowledgements

            Many thanks to Prof. Yong Zhang (Institute of Zoology, Chinese Academy of Sciences) and Prof. Tao Sang (Institute of Botany, Chinese Academy of Sciences) for invaluable suggestions and comments, and Dr. Quan-You Yu for help with the experiments. This work was supported by the Fundamental Research Funds for the Central Universities (No. CDJZR11290002) and by Natural Science Foundation Project of CQ CSTC (cstc2012jjB80007).

            Authors’ Affiliations

            (1)
            College of Life Sciences, Chongqing University
            (2)
            Department of Anesthesiology, Research Institute of Surgery, Daping Hospital, Third Military Medical University

            References

            1. Brosius J: Retroposons-seeds of evolution. Science 1991,251(4995):753.PubMedView Article
            2. Betran E, Thornton K, Long M: Retroposed new genes out of the X in Drosophila. Genome Res 2002,12(12):1854–1859.PubMedView Article
            3. Wang W, Brunet FG, Nevo E, Long M: Origin of sphinx, a young chimeric RNA gene in Drosophila melanogaster. Proc Natl Acad Sci USA 2002,99(7):4448–4453.PubMedView Article
            4. Nisole S, Lynch C, Stoye JP, Yap MW: A Trim5-cyclophilin A fusion protein found in owl monkey kidney cells can restrict HIV-1. Proc Natl Acad Sci USA 2004,101(36):13324–13328.PubMedView Article
            5. Sayah DM, Sokolskaja E, Berthoux L, Luban J: Cyclophilin A retrotransposition into TRIM5 explains owl monkey resistance to HIV-1. Nature 2004,430(6999):569–573.PubMedView Article
            6. Zhang J, Dean AM, Brunet F, Long M: Evolving protein functional diversity in new genes of Drosophila. Proc Natl Acad Sci USA 2004,101(46):16246–16250.PubMedView Article
            7. Baertsch R, Diekhans M, Kent WJ, Haussler D, Brosius J: Retrocopy contributions to the evolution of the human genome. BMC Genomics 2008,9(1):466.PubMedView Article
            8. Fablet M, Bueno M, Potrzebowski L, Kaessmann H: Evolutionary origin and functions of retrogene introns. Mol Biol Evol 2009,26(9):2147–2156.PubMedView Article
            9. Lahn BT, Page DC: Retroposition of autosomal mRNA yielded testis-specific gene family on human Y chromosome. Nat Genet 1999,21(4):429–433.PubMedView Article
            10. Zhu Z, Zhang Y, Long M: Extensive structural renovation of retrogenes in the evolution of the Populus genome. Plant Physiol 2009,151(4):1943–1951.PubMedView Article
            11. Irimia M, Rukov JL, Penny D, Vinther J, Garcia-Fernandez J, Roy SW: Origin of introns by 'intronization' of exonic sequences. Trends Genet 2008,24(8):378–381.PubMedView Article
            12. Roy SW, Fedorov A, Gilbert W: Large-scale comparison of intron positions in mammalian genes shows intron loss but no gain. Proc Natl Acad Sci USA 2003,100(12):7158–7162.PubMedView Article
            13. Coulombe-Huntington J, Majewski J: Characterization of intron loss events in mammals. Genome Res 2007,17(1):23–32.PubMedView Article
            14. Szczesniak MW, Ciomborowska J, Nowak W, Rogozin IB, Makalowska I: Primate and rodent specific intron gains and the origin of retrogenes with splice variants. Mol Biol Evol 2011,28(1):33–37.PubMedView Article
            15. Emerson JJ, Kaessmann H, Betran E, Long M: Extensive gene traffic on the mammalian X chromosome. Science 2004,303(5657):537–540.PubMedView Article
            16. Marques AC, Dupanloup I, Vinckenbosch N, Reymond A, Kaessmann H: Emergence of young human genes after a burst of retroposition in primates. PLoS Biol 2005,3(11):e357.PubMedView Article
            17. Vinckenbosch N, Dupanloup I, Kaessmann H: Evolutionary fate of retroposed gene copies in the human genome. Proc Natl Acad Sci USA 2006,103(9):3220–3225.PubMedView Article
            18. Karolchik D, Hinrichs AS, Furey TS, Roskin KM, Sugnet CW, Haussler D, Kent WJ: The UCSC Table Browser data retrieval tool. Nucleic Acids Res 2004,32(Database issue):D493–496.PubMedView Article
            19. Kuhn RM, Karolchik D, Zweig AS, Wang T, Smith KE, Rosenbloom KR, Rhead B, Raney BJ, Pohl A, Pheasant M, Meyer L, Hsu F, Hinrichs AS, Harte RA, Giardine B, Fujita P, Diekhans M, Dreszer T, Clawson H, Barber GP, Haussler D, Kent WJ: The UCSC Genome Browser Database: update 2009. Nucleic Acids Res 2009,37(Database issue):D755–761.PubMedView Article
            20. Altschul SF, Madden TL, Schaffer AA, Zhang J, Zhang Z, Miller W, Lipman DJ: Gapped BLAST and PSI-BLAST: a new generation of protein database search programs. Nucleic Acids Res 1997,25(17):3389–3402.PubMedView Article
            21. Zhang Z, Carriero N, Zheng D, Karro J, Harrison PM, Gerstein M: PseudoPipe: an automated pseudogene identification pipeline. Bioinformatics 2006,22(12):1437–1439.PubMedView Article
            22. Hubbard T, Barker D, Birney E, Cameron G, Chen Y, Clark L, Cox T, Cuff J, Curwen V, Down T, Durbin R, Eyras E, Gilbert J, Hammond M, Huminiecki L, Kasprzyk A, Lehvaslaiho H, Lijnzaad P, Melsopp C, Mongin E, Pettett R, Pocock M, Potter S, Rust A, Schmidt E, Searle S, Slater G, Smith J, Spooner W, Stabenau A, Stalker J, Stupka E, Ureta-Vidal A, Vastrik I, Clamp M: The Ensembl genome database project. Nucleic Acids Res 2002,30(1):38–41.PubMedView Article
            23. Hubbard TJ, Aken BL, Ayling S, Ballester B, Beal K, Bragin E, Brent S, Chen Y, Clapham P, Clarke L, Coates G, Fairley S, Fitzgerald S, Fernandez-Banet J, Gordon L, Graf S, Haider S, Hammond M, Holland R, Howe K, Jenkinson A, Johnson N, Kahari A, Keefe D, Keenan S, Kinsella R, Kokocinski F, Kulesha E, Lawson D, Longden I, Megy K, Meidl P, Overduin B, Parker A, Pritchard B, Rios D, Schuster M, Slater G, Smedley D, Spooner W, Spudich G, Trevanion S, Vilella A, Vogel J, White S, Wilder S, Zadissa A, Birney E, Cunningham F, Curwen V, Durbin R, Fernandez-Suarez XM, Herrero J, Kasprzyk A, Proctor G, Smith J, Searle S, Flicek P: Ensembl 2009. Nucleic Acids Res 2009,37(suppl 1):D690–697.PubMedView Article
            24. Kent WJ: BLAT–the BLAST-like alignment tool. Genome Res 2002,12(4):656–664.PubMed
            25. Nei M, Gojobori T: Simple methods for estimating the numbers of synonymous and nonsynonymous nucleotide substitutions. Mol Biol Evol 1986,3(5):418–426.PubMed
            26. Yang Z: PAML: a program package for phylogenetic analysis by maximum likelihood. Comput Appl Biosci 1997,13(5):555–556.PubMed
            27. Desiere F, Deutsch EW, Nesvizhskii AI, Mallick P, King NL, Eng JK, Aderem A, Boyle R, Brunner E, Donohoe S, Fausto N, Hafen E, Hood L, Katze MG, Kennedy KA, Kregenow F, Lee H, Lin B, Martin D, Ranish JA, Rawlings DJ, Samelson LE, Shiio Y, Watts JD, Wollscheid B, Wright ME, Yan W, Yang L, Yi EC, Zhang H, Aebersold R: Integration with the human genome of peptide sequences obtained by high-throughput mass spectrometry. Genome Biol 2005,6(1):R9.PubMedView Article
            28. Deutsch EW, Lam H, Aebersold R: PeptideAtlas: a resource for target selection for emerging targeted proteomics workflows. EMBO Rep 2008,9(5):429–434.PubMedView Article
            29. Farrah T, Deutsch EW, Omenn GS, Campbell DS, Sun Z, Bletz JA, Mallick P, Katz JE, Malmström J, Ossola R, Watts JD, Lin B, Zhang H, Moritz RL, Aebersold R: A high-confidence human plasma proteome reference set with estimated concentrations in PeptideAtlas. Mol Cell Proteomics 2011,10(9):M110.006353.PubMedView Article
            30. Jones P, Cote RG, Martens L, Quinn AF, Taylor CF, Derache W, Hermjakob H, Apweiler R: PRIDE: a public repository of protein and peptide identifications for the proteomics community. Nucleic Acids Res 2006,34(Database issue):D659–663.PubMedView Article
            31. Vizcaino JA, Cote R, Reisinger F, Foster JM, Mueller M, Rameseder J, Hermjakob H, Martens L: A guide to the Proteomics Identifications Database proteomics data repository. Proteomics 2009,9(18):4276–4283.PubMedView Article
            32. Jenuth JP: The NCBI. Publicly available tools and resources on the Web. Methods Mol Biol 2000, 132:301–312.PubMed
            33. Johnson M, Zaretskaya I, Raytselis Y, Merezhuk Y, McGinnis S, Madden TL: NCBI BLAST: a better web interface. Nucleic Acids Res 2008,36(Web Server issue):W5–9.PubMedView Article
            34. Zhang YE, Vibranovski MD, Landback P, Marais GA, Long M: Chromosomal redistribution of male-biased genes in mammalian evolution with two bursts of gene gain on the X chromosome. PLoS Biol 2010,8(10):e1000494.PubMedView Article
            35. Wu NW, Jalkanen S, Streeter PR, Butcher EC: Evolutionary conservation of tissue-specific lymphocyte-endothelial cell recognition mechanisms involved in lymphocyte homing. J Cell Biol 1988,107(5):1845–1851.PubMedView Article
            36. Trusov YA, Dear PH: A molecular clock based on the expansion of gene families. Nucleic Acids Res 1996,24(6):995–999.PubMedView Article
            37. Thomas JW, Touchman JW: Vertebrate genome sequencing: building a backbone for comparative genomics. Trends Genet 2002,18(2):104–108.PubMedView Article
            38. Zhao S, Shetty J, Hou L, Delcher A, Zhu B, Osoegawa K, de Jong P, Nierman WC, Strausberg RL, Fraser CM: Human, mouse, and rat genome large-scale rearrangements: stability versus speciation. Genome Res 2004,14(10A):1851–1860.PubMedView Article
            39. Falkowski PG, Katz ME, Milligan AJ, Fennel K, Cramer BS, Aubry MP, Berner RA, Novacek MJ, Zapol WM: The rise of oxygen over the past 205 million years and the evolution of large placental mammals. Science 2005,309(5744):2202–2204.PubMedView Article
            40. Waters PD, Delbridge ML, Deakin JE, El-Mogharbel N, Kirby PJ, Carvalho-Silva DR, Graves JA: Autosomal location of genes from the conserved mammalian X in the platypus (Ornithorhynchus anatinus): implications for mammalian sex chromosome evolution. Chromosome Res 2005,13(4):401–410.PubMedView Article
            41. Schwartz S, Hall E, Ast G: SROOGLE: webserver for integrative, user-friendly visualization of splicing signals. Nucleic Acids Res 2009,37(Web Server issue):W189–192.PubMedView Article
            42. Cavalier-Smith T: Selfish DNA and the origin of introns. Nature 1985, 315:283–284.PubMedView Article
            43. Castillo-Davis CI, Bedford TBC, Hart DL: Accelerated rates of intron gain/loss and protein evolution in duplicate genes in human and mouse malaria parasites. Mol Biol Evol 2004,21(7):1422–1427.PubMedView Article
            44. Li W, Tucker AE, Sung W, Thomas WK, Lynch M: Extensive, recent intron gains in Daphnia populations. Science 2009,326(5957):1260–1262.PubMedView Article
            45. Roy SW, Gilbert W: Rates of intron loss and gain: implications for early eukaryotic evolution. Proc Natl Acad Sci USA 2005, 102:5773–5778.PubMedView Article
            46. The 1000 Genomes Project Consortium: A map of human genome variation from population-scale sequencing. Nature 2010,467(7319):1061–1073.View Article
            47. Kol G, Lev-Maor G, Ast G: Human-mouse comparative analysis reveals that branch-site plasticity contributes to splicing regulation. Hum Mol Genet 2005,14(11):1559–1568.PubMedView Article
            48. Schwartz SH, Silva J, Burstein D, Pupko T, Eyras E, Ast G: Large-scale comparative analysis of splicing signals and their corresponding splicing factors in eukaryotes. Genome Res 2008,18(1):88–103.PubMedView Article

            Copyright

            © Kang et al.; licensee BioMed Central Ltd. 2012

            This article is published under license to BioMed Central Ltd. This is an Open Access article distributed under the terms of the Creative Commons Attribution License (http://​creativecommons.​org/​licenses/​by/​2.​0), which permits unrestricted use, distribution, and reproduction in any medium, provided the original work is properly cited.

            Advertisement